Aschafenburg and Mullen Phosphatase Test Buffer |
|||
NPD04 | Scientific Laboratory Supplies | PK12 | EUR 223.2 |
Antibody Elisa Laboratories manufactures the elisa and immunofluorescent antibody test for chargas reagents distributed by Genprice. The Elisa And Immunofluorescent Antibody Test For Chargas reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact antibody elisa. Other Elisa products are available in stock. Specificity: Elisa Category: And Group: Immunofluorescent Antibody
Test for Enteropathogenic.C |
||
Scientific Laboratory Supplies | PK50 | EUR 215.46 |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Immunofluorescent Antibody information
Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLAKT1AP463120UL | Innovative research | each | EUR 247 |
Description: Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLAKT1AP463200UL | Innovative research | each | EUR 383 |
Description: Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLBAXAP819120UL | Innovative research | each | EUR 247 |
Description: Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLBAXAP819200UL | Innovative research | each | EUR 383 |
Description: Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLCAV1AP778120UL | Innovative research | each | EUR 259 |
Description: Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLCAV1AP778200UL | Innovative research | each | EUR 403 |
Description: Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLEGFRAP281120UL | Innovative research | each | EUR 259 |
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLEGFRAP281200UL | Innovative research | each | EUR 403 |
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLEGFRAP291120UL | Innovative research | each | EUR 259 |
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLEGFRAP291200UL | Innovative research | each | EUR 403 |
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLH3C1AP686120UL | Innovative research | each | EUR 259 |
Description: Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLH3C1AP686200UL | Innovative research | each | EUR 403 |
Description: Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLHK1AP755120UL | Innovative research | each | EUR 259 |
Description: Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLHK1AP755200UL | Innovative research | each | EUR 403 |
Description: Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLJAK2AP844120UL | Innovative research | each | EUR 259 |
Description: Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLJAK2AP844200UL | Innovative research | each | EUR 403 |
Description: Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
Rabbit Anti JAK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |
|||
IRBAMLJAK3AP846120UL | Innovative research | each | EUR 259 |
Description: Rabbit Anti JAK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) |