Elisa And Immunofluorescent Antibody Test For Chargas

Aschafenburg and Mullen Phosphatase Test Buffer

NPD04 PK12
EUR 223.2

Antibody Elisa Laboratories manufactures the elisa and immunofluorescent antibody test for chargas reagents distributed by Genprice. The Elisa And Immunofluorescent Antibody Test For Chargas reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact antibody elisa. Other Elisa products are available in stock. Specificity: Elisa Category: And Group: Immunofluorescent Antibody

Test for Enteropathogenic.C

PK50
EUR 215.46

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Immunofluorescent Antibody information

Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLAKT1AP463120UL each
EUR 247
Description: Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLAKT1AP463200UL each
EUR 383
Description: Rabbit Anti AKT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLBAXAP819120UL each
EUR 247
Description: Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLBAXAP819200UL each
EUR 383
Description: Rabbit Anti BAX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLCAV1AP778120UL each
EUR 259
Description: Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLCAV1AP778200UL each
EUR 403
Description: Rabbit Anti CAV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLEGFRAP281120UL each
EUR 259
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLEGFRAP281200UL each
EUR 403
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLEGFRAP291120UL each
EUR 259
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLEGFRAP291200UL each
EUR 403
Description: Rabbit Anti EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLH3C1AP686120UL each
EUR 259
Description: Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLH3C1AP686200UL each
EUR 403
Description: Rabbit Anti H3C1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLHK1AP755120UL each
EUR 259
Description: Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLHK1AP755200UL each
EUR 403
Description: Rabbit Anti HK1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLJAK2AP844120UL each
EUR 259
Description: Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLJAK2AP844200UL each
EUR 403
Description: Rabbit Anti JAK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

Rabbit Anti JAK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)

IRBAMLJAK3AP846120UL each
EUR 259
Description: Rabbit Anti JAK3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA)